PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_62CC650D3.1
Common NameMybFhb5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 144aa    MW: 16407.8 Da    PI: 10.1195
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_62CC650D3.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l+  +k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_5AS_62CC650D3.1 14 KGAWTKEEDQRLIAHIKDHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding58.12e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+++ eEdel++++++ lG++ W++Ia +++ gRt++++k++w+++
  Traes_5AS_62CC650D3.1  67 RGNFSDEEDELIIKLHEFLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.602961IPR017930Myb domain
SuperFamilySSF466891.51E-2913108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002494.5E-151461IPR001005SANT/Myb domain
CDDcd001676.87E-111661No hitNo description
PROSITE profilePS5129427.08662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2865116IPR009057Homeodomain-like
SMARTSM007173.2E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667111IPR001005SANT/Myb domain
CDDcd001673.28E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIK DHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDELIIK LHEFLGNKWS LIAGRLPGRT DNEIKNYWNT HVKRKLLARG  120
VDPQTHRPLN AGTTAVQGMH TPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-311311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2261400.0KF226140.1 Triticum aestivum cultivar RNIL_Sumai3 R2R3-Myb transcription factor (MybFhb5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.12e-89hypothetical protein SORBIDRAFT_03g041360
SwissprotP813933e-88MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A126CZG41e-104A0A126CZG4_WHEAT; R2R3-Myb transcription factor
TrEMBLW5F4T31e-105W5F4T3_WHEAT; Uncharacterized protein
STRINGMLOC_63914.11e-100(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-88myb domain protein 6